Session 04 - "Echoes in the Green"
Audio đ¶
"Echoes in the Green"
(A Bardic Ballad for Lute, Chapter Four)
[Verse 1]
In Kryptgardenâs mist, âneath a moon so pale,
Rig stood on watch, saw a lightâs green trail,
A pond aglow, where a witch did stand,
Whispered of doom in this forest land.
Valen awoke, his magic did flare,
Detected the glow in the dragonâs lair,
High Jinks peered in, saw a scryerâs gleam,
Lords in Waterdeep, a troubled dream.
[Chorus]
Strum the lute, hear echoes keen,
A witchâs gaze in forests green,
Stars above where shadows creep,
Echoes in the Green run deep!
[Verse 2]
The Green Witch spoke, her voice a chill,
âHumans trampled my woods, yet I spared their ill,
Two Mind Flayers took them, to the Underdarkâs gate,
North to the mountains, go seal their fate.â
Leydrick and Dino, tense in her glow,
While High Jinks bowed, her charm did show,
They left with care, no tree to scar,
For the Witchâs wrath could strike from afar.
[Chorus]
Strum the lute, hear echoes keen,
A witchâs gaze in forests green,
Stars above where shadows creep,
Echoes in the Green run deep!
[Verse 3]
Blue lights awoke them, a fainter hue,
Valen groaned loud, âNot this anew!â
High Jinks and Rig crept through the night,
Found a stone path, with wisps of light.
Elven songs hummed, a castleâs trace,
A basement deep in that ancient place,
High Jinks claimed a ring to speak with beasts,
Valen took potions for battles unleashed.
[Bridge]
Spiders struck fast on that haunted trail,
Dinoâs blade swung, their hides did flail,
High Jinks danced back, her blasts did sing,
While Valen took hits, his wounds did sting.
Leydrickâs prayer brought a healing bloom,
Cured Valenâs scars âneath the forest gloom,
Rig with his wrench, though webbed, broke free,
This chapterâs fight in the green canopy.
[Outro]
So raise the lute for the path they tread,
To Underdarkâs cave or an elven thread,
Mind Flayers wait, or wisps deceive,
Echoes in the Green, what fate will weave?
đȘ Campaign Arc
Campaign: Spelljammer â Homebrew Hybrid
Session 4Title: SummaryThe Green Witchâs Warning
Dungeon Master: James/Jamie (Sicareus)
Setting: Kryptgarden Forest â Sword Mountains â Underdark
đ§ Overview
Characters
As (Unchanged)the
- party
RigcontinuedDerektheirDalhartpursuit(RuggedofHumantheRogue):vanishedPractical,Rassalantarstealthy,townsfolk,wielding a two-handed wrench. Took watch, scouted strange lights,they encountered the legendary GreenWitch,Witchâanfoughtancientspidersgreen dragon scrying the politics of Waterdeep. She pointed them toward a Mind Flayer-infested cave in theUnderdarkSword(gotMountains,webbednowbutconfirmedescaped),as the path to the Underdark. Along the way, the group explored ancient elven ruins andmissedfoughtseveralaattacksdeadlydespiteambushheroic inspiration.Leydrick Giffenhall (Stout Dwarf Cleric): Devout and supportive. Foughtby spiderswith Firebolt, healed Valen with Cure Wounds (fully restoring his health), shot a Firebolt atand a Drowinwithin the Underdark(hittingtunnels.butThenotjourneykilling),deepens the mystery of the townsfolkâs fate, intertwining planar threats andexpressedforgottendisdainelvenforlore.spiders.Highđ§âđ€âđ§
JinksParty MembersCharacter Player Class / Subclass Race Notable Actions Garrick "Rigg" Dalhart Ben / Elemunk Rogue ( YoungSwashbuckler)FemaleHuman Tabaxi Warlock): Charismatic and reckless, with a sphinx familiar (Tiv). Used Awakened Mind, looked intoScouted the Green Witchâs scrying pond,pool; was webbed in battle; missed attacks despite Heroic Inspiration.Laydrick Gefinhal Jared / Galindis Cleric (Life Domain) Dwarf Critically healed Valen; fought spiders with EldritchFirebolt;Blast, disengaged using Feline Agility, and receivedstruck aringDrowtointalkthe dark.High Jinks Kate / Keitachan Warlock (Great Old One) Tabaxi Interacted peacefully with animals.the- Green Witch; identified will-oâ-wisps; acquired animal-talking ring.
Dino Roar (Dynoth Rokos) Robb / DynothBaconbuffRokosArtificer / Fighter ( TallBattle Smith)Githyanki Artificer):Damaged Strategic,spiders;withwaryaofSteeltheDefender. Fought spiders alongside hisdragon; Steel Defender active.Valen Pyre Justin / Slitzer Wizard (Evoker) Human Used Detect Magic; looted potions; heavily injured but fully healed during spider ambush.
đ Key Locations
-
Kryptgarden Forest: Dragon-claimed territory. Lush, dangerous, and ancient.
-
Green Witchâs Scrying Pond: Source of visions into Waterdeep politics and movements.
-
Overgrown Elven Path: Lined with will-oâ-wisps, ending in ruins with basement loot.
-
Cave to the Underdark (Sword Mountains): Passage to Mind Flayer domain and home of current ambush.
đ§ Notable NPCs
NPC Description The Green Witch Ancient green dragon. Allowed safe passage, revealed Mind Flayer location. Dislikes intruders. Will-oâ-Wisps Haunting blue lights along an ancient elven path. Possibly dangerous. Drow Ambusher Fought the party in the Underdark; injured but escaped into the darkness.
đ Quests
Quest Name Source Status Details Investigate Rassalantar Miners đ Active Now in the Underdark, dealtwheresignificantMinddamage,Flayers hold the townsfolk. Spiders andcoordinatedDrowwithencountered.theparty.ValenLocate PyreBeholder(FlamboyantSir HumanGwenWizard,đ playedPendingbyCave Justin):maySpell-focused,connectreturnedtoafterthismissingquest;Sessionstill3.unresolved.WokewithHighAncient Jinks,ElvenLeydrick,PathDiscovered đ€ On Hold Strange ruins and Dino,music,used Detect Magic, was reluctanttied towake for the second lights, took heavy damage in the spider fight (low health), was healed by Leydrick,will-oâ-wisps andfoundatwoMoon-TouchedgreaterLongsword.healingpotionsand an unknown mushroom potion.
SettingInitialLocation:
Kryptgardenâïž
Forest,KeynearEventstheđż
SwordScryingMountains, a few daysâ travel from Rassalantar and Westwood. The forest is lush and misty, under the influence ofwith the Green Witch(an-
greenRig
dragon).scouted glowing pond; found a mysterious woman staring into it. LaterLocation:High
TheJinksUnderdark,ledaccesseddiplomacy;viaGreenaWitchcaveshowedatWaterdeepthenoblesbaseinofscrying pond.-
She identified Mind Flayer lair in the Sword Mountains
(asanddirected by the Green Witch), wherewarned the partyencounteredtospidersleave her forest. -
Party agreed and
awithdrewDrow.peacefully, Time: About a weekimpressed andaunnerved.half after leaving Rassalantar, now pursuing the townsfolk in the Underdark.
ancientSession 4 RecapCamping in Kryptgarden ForestThe party camped in Kryptgarden Forest, pursuing the 200 missing Rassalantar townsfolk, believed to be under Mind Flayer control. Rig took the first watch, followed by Dino, with High Jinksâ sphinx familiar (Tiv) and Dinoâs Steel Defender guarding the camp.During Rigâs watch, he noticed strange greenish lights in the forest, a few minutesâ walk away. Using stealth (possibly with Boots of Elvenkind from Session 3), Rig approached, spotting a glowing pond with a greenish hue and a woman in green staring into it. Wary of danger, Rig returned and woke High Jinks, Leydrick, Dino, and Valen to report the âweird chick staring into a glowing pond.â
Encounter with the Green Witch
đ” Lights in the Forest
HighJinks,Blue
Leydrick,lightsDino,appeared laterâwill-oâ-wisps along an overgrown elven path.-
Faint stringy music in Elvish confirmed by Rig (Perception 21).
-
Found ruins and
Valenlooted:investigated,-
TivFancy
andmediumthe Steel Defender to guard their supplies. Rig led them to the pond, where Valen used Detect Magic, revealing the pond and woman radiated strong magical energyarmor (âlightingunclaimed)up like a Christmas treeâ). The woman, identified as the Green Witch, invited High Jinks to look into the pond, which she was using for scrying. The pond showed lords and ladies in Waterdeep discussing the Rassalantar disappearances. TheGreen Witch confirmed she saw the townsfolk pass through her forest, trampling plants, but deemed them not worth killing. She revealed their destination: a cave to the north, at the baseRing of
theAnimalSword Mountains, leading to the Underdark, where two Mind Flayers had taken them. She urged the party to retrieve the townsfolk and leave her forest, warning of conflict if more humans intruded. High Jinks, enjoying the interaction, conversed politely, while Valen admired her magic, and Leydrick and Dino were stressed by the dragonâs presence. The party agreed to follow her directions and retreated carefully, avoiding further disturbanceSpeech (HighJinksJinks)reminded-
not2
togreaterhurthealingtrees).potions + unknown mushroom potion (Valen)
leavingeveryone -
More Lights and a Mysterious Path
đ·ïž Underdark Ambush
BackatEntered
camp,Underdarkthe party rested, but during the next watch, fainter blue lights appeared. High Jinks, woken by Tiv, and Valen investigated, with Valen reluctantly waking up (grumbling about being disturbed again). Rig joined them, stealthily following the lights despite his frustration. The lights led to an overgrown stone path with occasional blue flashes and faint, stringy Elven music in the distance (Rig, who speaks Elvish, confirmed its distinctly Elven nature with a perception check of 21, noting its haunting, string-like quality).The path led to a clearing with no trees, revealing a castle footprintâevidence of a large, unnatural structure long gone. Small plants had overgrown the area, and the blue lights were identified as will-oâ-wisps (per High Jinksâ Arcana check, 19). High Jinks worried they might lead to doom, but the party, drawn by the Elven music, investigated further, finding a basement in the castle ruins. They looted: fancy medium armor, a ring allowing High Jinks to talk with animals (given to her), and Valen found two greater healing potions and an unknown potion with mushrooms.The pathâs direction was away from the Sword Mountains (interpreted as veering off to the side), not toward the cave the Green Witch mentioned. However, the party ultimately chose to follow thethrough Green Witchâsadvicecave.-
Ambushed by 4 spiders + 1 Drow:
-
Dino and
headedSteelnorthDefendertostruckthehard.Sword -
cave,Leydrick
enteringusedtheFirebolt,UnderdarkCuretoWoundspursue(restoringtheValentownsfolk.fully). -
High Jinks hit, disengaged with Feline Agility.
-
Rig missed key attacks, was webbed but escaped.
-
Valen took heavy damage, then was fully healed.
Mountains -
-
Combat ongoing. Two spiders remain (one injured), Drow wounded and retreating.
Underdark: Spider and Drow Ambush
After entering the Underdark via the cave at the base of the Sword Mountains, the party was ambushed by four large spiders and a Drow. Combat ensued:Dino: Led the charge, dealing significant damage with his sword (8 damage, killing one spider) and directing his Steel Defender to attack (14 to hit, dealing further damage).Leydrick: Used Firebolt to damage a spider (nearly killing it). A Drow shot an arrow at him from the darkness but missed; Leydrick fired a Firebolt back into the darkness, hitting the Drow (who remained alive). Later, Leydrick cast Cure Wounds on Valen, fully restoring his health (noted as âinsaneâ healing per 2024 D&D rules). He expressed disdain for spiders.High Jinks: Hit a spider with Eldritch Blast but was bitten. She disengaged using Feline Agility to double her movement and retreat, avoiding an opportunity attack, and later dashed to safety.Rig: Rushed to Leydrickâs aid, swinging his wrench but missing twice (despite using Heroic Inspiration). A spider webbed him, restraining him (speed 0, attacks at disadvantage), but he used a bonus action to disengage and escape.Valen: Used Firebolt to finish off a damaged spider but took several nasty hits, reducing him to low health. Leydrickâs Cure Wounds fully healed him, keeping him in the fight.The spiders and Drow landed hits: one spider bit Dino (failing to penetrate his armor), another dealt 5 damage to Leydrick via a crossbow bolt (he passed a Constitution saving throw), a third webbed Rig, and several hit Valen (bringing him to low health before healing). The Drowâs arrow missed Leydrick, but Leydrickâs Firebolt hit the Drow, who survived and remained in the darkness. By the sessionâs end, two spiders were dead, one was heavily damaged, one remained at full health, and the Drow was injured but alive.
đ° Loot & Items
Source Item / Amount Notes Elven Ruins Fancy medium armor (unclaimed), Ring of Animal Speech (High Jinks), 2 Greater Healing Potions, 1 Unknown Mushroom Potion (Valen) Found in basement near will-oâ-wisps. Previous Loot Wand of Translocation (Valen) From Session 2; may still be key to planar travel.
đ Current Status
-
Location: In the Underdark, mid-combat near
theSwordentrance of theMountains caveatentrance.the base of the Sword Mountains, mid-combat with two remaining spiders and an injured Drow. -
Party
Condition:Health:
-
Dino:
TookLightminordamage.damage, Steel Defender active. -
Leydrick: 5 damage from
acrossbowbolt,bolt.otherwise stable. -
High Jinks:
Bitten butBitten, retreatedsafely,safely.no major injuries. -
Rig: Webbed
brieflyand missed attacks, butescaped,escaped.uninjured, frustrated after missing attacks. -
Valen:
TookWasheavyneardamagedeath,(low health),now fully healed byLeydrick,Leydrick.equipped with two greater healing potions and an unknown mushroom potion.
-
QuestsCombat:
Updated:Two Investigate Rassalantar Disappearance: The party has entered the Underdark, following the Green Witchâs directions, and encountered enemies (spiders and aDrow),Drowconfirmingremaintheactive.presence of threats guarding the townsfolk.LocateBeholderResources:
in-
Mountains:Potions
Still(Valen),pending,SteelpotentiallyDefendertied(Dino),toSpynkstheFamiliarUnderdark(Highcave.Jinks)
Sword-
NewLead:Mind
TheFlayerstoneLair:path,Confirmedwill-oâ-wisps,direction via Green Witch; imminent confrontation likely.-
Elven
music,Ruins: Musical magic, glowing lights, andcastle footprint (witha basementloot)of relics suggestandeeperancient elven site,loreâpossibly tied to the Moon-Touched Longsword.The -
choseBeholder
toTie-In:pursueSword Mountains are theUnderdarkallegedinsteaddomainbutofmaySirreturnGwenâstobeholder.this lead later. LootAcquired:FancymediumMind
armorFlayer(unclaimed).Ring to talk with animals (given to High Jinks).Two greater healing potions and an unknown mushroom potion (taken by Valen).High Jinksâ interaction with the Green Witch ensured a peaceful encounter, though Leydrick and Dino were on edge.Valenâs use of Detect Magic and reluctance to wake up again highlighted his cautious but curious nature.The basement loot added utility (High Jinksâ ring) and survival options (Valenâs potions), crucial for the Underdark.Combat dynamics: Dinoâs aggression, Leydrickâs critical healing and retaliation against the Drow, High Jinksâ hit-and-run, Rigâs protective instincts (despite misses),presence and ValenâsresilienceWand.after taking hits.AhumorousGreen
out-of-characterWitchâsmomentscryingdiscussedandaextraplanarrestaurantawareness.named-
Sister,âElven
likelyruinsacouldtranslatedtienametoforancientanplanarAsiancrossingsfusionorbrunchSpelljammerspot.tech.
đ§© Ongoing Threads & Plot Hooks
Spelljammer Hints:






